DPCstruct | MC61285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 222 ± 45 aa |
| Standard deviation of domain lengths | 45.10 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0651 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9S436 | 6-225 | SSEIETNTDSLDNSIIFHVIKNTVFLCLFRKCFLTSRSLCGSVLQDITLEYDSLKEEYEEMMAVAQAEAKASTKRKHISRMREVRIG… |
| A0A3Q3IWJ5 | 63-247 | CVNVVFPGTVTQEGCCRFVSEILKCILYQRQQLPMTYDQLVYSQRKRIVPSADMDWRKCQQTLQELEEVLQQLEVLFSLSRVPRVLL… |
| T1FKB8 | 7-235 | None |
| A0A835R9P1 | 1-242 | None |
| A0A067RGK2 | 22-243 | None |
| A0A6T7GJ10 | 37-307 | None |
| A0A5E4A937 | 2-194 | None |
| A0A556U780 | 457-662 | None |
| A0A044V7Y7 | 436-656 | None |
| F4QE24 | 10-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.