DPCstruct | MC61284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 214 ± 28 aa |
| Standard deviation of domain lengths | 28.33 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A343B740 | 1-217 | MIKTIKYNLNNLMVTNEVLNSYILRFWDDVFAPLIQDGSIKHLMVLCKVKYSESEAESGYKTLGPLRRVEFKDLELFKDYLIDRIGI… |
| A0A895KV26 | 2-223 | QTKKYNINENLTLTPNLLKYYVSLFWADVFTQHKDNHFMLMCKVLFNNEIGSSEVKSIGQMRNVNYSDMNAYCEYLVNRLGILTDSY… |
| A0A7T3PCP6 | 69-301 | None |
| A0A6C0W3U7 | 11-244 | None |
| A0A5B9RC75 | 2-173 | None |
| A0A5B9R923 | 2-174 | None |
| Q01529 | 59-221 | None |
| A0A895KUE4 | 53-280 | None |
| A0A386TY72 | 3-248 | None |
| A0A5Q0N246 | 1-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.