DPCstruct | MC6128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Standard deviation of domain lengths | 9.96 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6LRA9 | 266-369 | DLTKLYDSPDLTFGTFSILFDPRSNDLDSLSLLRVKFQRPKLDSCSLCLYGLISRKQAIELSELDDDVKRMEMLYHNFQVRLVARKG… |
| A0A0A9GCM6 | 3-122 | PDLAFGRFSFVFSSVTPDDSEALGLARISLDKRLLLHPKDHESKEDQKDQDPAAEKIDHGAFHLYATVSREQADRLRLSSDDDKSRL… |
| A0A6J1IZB6 | 626-756 | None |
| A0A7J9I4P9 | 276-392 | None |
| A0A7N0TM98 | 86-201 | None |
| A0A072UVV1 | 166-267 | None |
| A0A2N9F614 | 132-265 | None |
| A0A7J0GP15 | 469-588 | None |
| A0A540KR58 | 181-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.