DPCstruct | MC6127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 147 ± 20 aa |
| Standard deviation of domain lengths | 20.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0HFQ4 | 6-151 | KGVIDFVNRCLAFESIEVGHYLKAVRDLDSILFGFEDVYTFFLKSKHNVLLNLIGLHYCLIWLGLPGECVMEILNNSNISQREVRVQ… |
| A0A0A9GA50 | 1-117 | MTDIGFLDVQFFLFSRNHSAIINLIGLHYSIASLHVPPNEVGKALQARQVAERRVCVNLLKLGRWFYGFRLPDENESRKISLSDLTM… |
| A0A835PHL5 | 68-257 | None |
| A0A7S3AXV3 | 34-176 | None |
| A0A833RGN7 | 78-239 | None |
| A0A833RB94 | 17-162 | None |
| A0A7J7PBU1 | 328-489 | None |
| A0A7I8KRL4 | 93-242 | None |
| A0A7S1SJY5 | 162-308 | None |
| A0A388L1B8 | 236-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.