DPCstruct | MC61261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 133 ± 25 aa |
| Standard deviation of domain lengths | 24.53 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.34 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0161- CL0036- CL0288 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376FFY2 | 1-121 | MKQPGEELQETVTELDDRAVVDYLLRNPEFFIRNARVVEEMRVPHPVRGTVSLVEWHMARSRNHINQLEENMTLLMEQASTNESLFY… |
| A0A090QZR5 | 1-120 | MSDVTSLARPSSPAGLTEQDVADFLQANPDFFIRQPDLLTRIQVHHTERGVVSLVDIQLERLRRQVGELEEKISGLISAASKNSALF… |
| A0A7X7CRB2 | 44-159 | None |
| A0A6A5KW19 | 267-371 | None |
| A0A6G9IAN9 | 138-315 | None |
| A0A378CJV5 | 1-117 | None |
| A0A2A5CWG5 | 1-117 | None |
| Q3JX96 | 301-416 | None |
| A0A812L6G8 | 239-394 | None |
| A0A379T265 | 1-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.