DPCstruct | MC6126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 154 ± 23 aa |
| Standard deviation of domain lengths | 22.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 64.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078GH94 | 26-158 | HDALVDAYDTNLIIECEPEYLMPHFGSNPDIDEKPPMPLRDCLEKEAIDEAMKQAPLMKDIVDHYSGPDRVTAKTQNEELDRIATTV… |
| A0A0A9G994 | 2-150 | EDAYLDACHTNNMIEFEPEYHVNFDNPDISEKPPMSLEEMLQKVKPFIVAYEGIQNQEEWEEAVKDVMARAPYMKELIDMYSGPDVV… |
| A0A4D9C0N8 | 228-402 | None |
| A0A2R6PJQ2 | 3-145 | None |
| A0A803LP01 | 268-440 | None |
| A0A2G5EC23 | 309-481 | None |
| A0A0D9WSZ6 | 180-351 | None |
| A0A811MNR1 | 685-833 | None |
| A0A835M910 | 78-250 | None |
| D7SNG6 | 34-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.