DPCstruct | MC61246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Standard deviation of domain lengths | 8.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 44.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4CBA5 | 150-236 | MVIFSGFWTVGTILEASLAWLIMPSLGWRWLLALSSIPSSLLLMFYKWTPESPRYLILQGRKAEALSILEKIARTNGTQLPKGVLGS |
| A0A402G8J8 | 9-94 | LLIEVFWAIGTVFEVLLAVFVMPTLGWRWLLILSALPLLLFAVLCFWLPESARYDVLSGNQEKATATLQRIAKENGAPMPLGKLII |
| A0A1I7YXW7 | 288-392 | None |
| B9FY07 | 133-218 | None |
| A0A0A9DX73 | 1-89 | None |
| A0A812RP73 | 2-84 | None |
| A0A2H1C5Q9 | 2-88 | None |
| A0A287S789 | 1-89 | None |
| A0A6A5DPP5 | 452-559 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.