DPCstruct | MC61245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 226 ± 66 aa |
| Standard deviation of domain lengths | 65.62 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 71.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L9TV94 | 7-119 | LSDKDSEDEVDDDVADFEDRRMLENFVDVSKDEKNFMHMWNSFVRKHRVIADGHISWACEAFSKLHAPEFVRSRSLAGCWRIFMVKL… |
| A0A7S4NGS4 | 35-252 | PPYEPQHKEHLVDFVFIRRDKQLCFPSPPFANIPSHKIAKLDSNERKKRVRLLEMQAAGQETVSRYTHCDRFPVRQYYHSRTKLPML… |
| A0A6D2I551 | 263-479 | None |
| A0A5N6Q8Z1 | 480-669 | None |
| A0A0D8XRM9 | 199-408 | None |
| A0A2P2MKG4 | 80-379 | None |
| A0A2G2X4Q9 | 157-355 | None |
| R1C902 | 220-384 | None |
| A0A3M7LY67 | 132-391 | None |
| A0A1Y2J5X7 | 102-506 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.