DPCstruct | MC6124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 114 ± 14 aa |
| Standard deviation of domain lengths | 13.97 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 61.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0650 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833W1H9 | 47-169 | GITAGICILIQHVPEKNGDRYEAIFSFYFGEYGHISVQGPYLTYEDTYLAVTGGSGIFEGVTGQVKLHQIVFPFKIFYTFYLKGIPD… |
| A0A6A3ABT0 | 1-124 | MGITAGICILVENKPEIKGDRYEAIYSFYVGDYGHMTVQGHYLTYQDTCLAITGGSGIFVVVTDQVKLRQIVFPFKIFYTFYLRGIG… |
| A0A1R3KID6 | 469-591 | None |
| A0A6A6MD78 | 318-440 | None |
| A0A1R3IC86 | 69-181 | None |
| A0A2N9IVE8 | 3-91 | None |
| A0A2U1LE98 | 1-118 | None |
| A0A087GYX3 | 137-239 | None |
| A0A4D6QFT9 | 171-303 | None |
| A0A118HFR8 | 111-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.