DPCstruct | MC61230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 166 ± 29 aa |
| Standard deviation of domain lengths | 28.93 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M9DR79 | 25-206 | VEKFTPETFSETDIPENIKKQEKAKIIGGAKWKDKQGSFLLILVEIPLFKKLSKESPNDSINQVEAQAYLFKNGIQIQKYLIVESHK… |
| A0A0Q4LG29 | 11-154 | FKFKGSRAMMVDRIDDDSSKNIFVFSKVKSGSNPDTLFAQKFTKIGDSWKLTQEKTITHKGIISIWGSRKAFGDADKDKRVDALFIY… |
| A0A7X0CGY3 | 3-160 | None |
| A0A3D3G6T5 | 225-369 | None |
| A0A4V1EED1 | 3-127 | None |
| A0A7Y6YF89 | 211-425 | None |
| A0A2E2Z8L4 | 18-180 | None |
| A0A5D4HF20 | 24-189 | None |
| A0A2H3KGL0 | 1-132 | None |
| A0A7L4TES4 | 5-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.