DPCstruct | MC6123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 215 ± 30 aa |
| Standard deviation of domain lengths | 30.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498IB14 | 151-370 | MDLWDRMCTLLRTRAICVKDNSMKAGMDLRLLFGVACGRSWFDKWGYKFYRGSYGISRFAYVDSLNHIGSLELSKMTESSFGHQLQA… |
| A0A6A3A4H0 | 1-234 | MNFWDRLCSLLSVRKVTVMDVSKKYGIEYRLLHAITRGHSWYGNWGYEFGSGSYALTREAYKKAVNDLSNMPLSTLLFQRNKSRMRL… |
| A0A4P1R8C1 | 774-981 | None |
| A0A4S4DHK0 | 260-455 | None |
| A0A1R3KCS4 | 1-195 | None |
| A0A6D2I636 | 65-275 | None |
| V9P4Y9 | 1-170 | None |
| A0A2P2MM24 | 209-426 | None |
| A0A2G5DU39 | 43-259 | None |
| A0A4S4E5R7 | 73-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.