DPCstruct | MC61223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 6.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05730 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8LRC6 | 10-94 | LAFAAVAVHAQDLSGVDECIIDCVTSAASSNGCSSFTDLSCVCSNTQFQQASLSCLQSKCTQDDVNNAMQLQQAQCGSTGSASAS |
| A0A7C8TW77 | 9-92 | AAFLLSNSAVSAIGINDYPGCALQCIAKNIVETGCGLMDFKCSCKNKQFLVASGKCIFKSCSIGEALKASGVSVGICAAAGLGI |
| A0A5K1JYS9 | 1-96 | None |
| A0A5M3MLQ9 | 17-119 | None |
| A0A0D7AI58 | 1-92 | None |
| A0A0E9NFX1 | 5-91 | None |
| A0A1L7XH21 | 1-88 | None |
| A0A0C3BL79 | 7-103 | None |
| V2XE56 | 3-88 | None |
| A0A2V1D402 | 7-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.