DPCstruct | MC61219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 97 ± 20 aa |
| Standard deviation of domain lengths | 19.60 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.92 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0378- PF02547 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X4DZ44 | 14-106 | RVWAVGTTVVRTLESVAAGRERIAPGRGSTDLFISPPFRFRAVDSLVTNFHLPRSTLLMLVAAFAGTERVLEAYEEAVATGYRFYSY… |
| A0A6G5SFJ9 | 307-413 | AADLINDRRASGGRILVVGTSALRALETVTGPDGRTQPGSGSTSLRIMPGHRFRACDAFLTNLHEPRSSELILVAALTGRDFLLDTY… |
| A0A6A0ASZ2 | 494-600 | None |
| A0A812NKX3 | 206-329 | None |
| A0A1M3SZH3 | 226-326 | None |
| A0A6J7UL08 | 5-80 | None |
| A0A378N7G4 | 1-102 | None |
| A0A525VXQ4 | 151-256 | None |
| A0A7J9YW39 | 129-235 | None |
| A0A7V9RF41 | 2-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.