DPCstruct | MC61211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 178 ± 21 aa |
| Standard deviation of domain lengths | 21.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P6G410 | 3-176 | LCGAKKRGNGEPCKRHAIPGSSRCKLHGGKGSGAPKGSKNAAKPGSLYSQFLTAEENAILPSIELGSVDGELRLTRIRLMRALNQEN… |
| A0A0F9CST1 | 9-177 | AKLCGANKTDGSGKCKQPAGWGTGTGRGRCKKHGGNTRAHKVKAQREAAEEAVAVYGLPIEIDPTDALLEEVWRSSGIVRYLDQVIR… |
| A0A1F4JM26 | 3-143 | None |
| A0A1I7D6E3 | 43-225 | None |
| A0A1B9NLA9 | 4-180 | None |
| A0A3D1FT26 | 56-231 | None |
| G1V4W5 | 2-201 | None |
| A0A6M3L1B9 | 2-162 | None |
| A0A430AU39 | 60-260 | None |
| A0A1X1MM54 | 4-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.