DPCstruct | MC6121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 127 |
|---|---|
| Mean domain length (aa) | 86 ± 16 aa |
| Standard deviation of domain lengths | 15.65 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 67.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.59 |
| Pfam Score | 98.89 |
| Assigned Pfam label(s) | CL0167- PF20428- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D9BQX0 | 8-59 | SEEKKIRSSSPKSCTDCRTTRTPLWRGGPHGPKSLCNACGIKYNKKRRESLG |
| A0A6A2ZWB9 | 14-96 | AQPYPHQATKSSRGSNGNSSNSSGNDPLLALRCANCDTTSTPLWRKGPRGPKSLCNGIRFKKEERRASAANGNNNSSMVEQQH |
| H2B026 | 1-63 | None |
| A0A5P1EV41 | 3-95 | None |
| K8EC02 | 1-75 | None |
| A0A1X6PKP2 | 2-77 | None |
| A0A7N0TJA2 | 5-88 | None |
| F4PRE1 | 118-237 | None |
| A0A0K9QSF5 | 1-89 | None |
| A0A445JGN2 | 68-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.