DPCstruct | MC6120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Standard deviation of domain lengths | 8.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9ELL8 | 5-106 | RCNRKIFRKSKSLRELLPGKPVAINIEPWWLVAPGSILESDVKLLNKDEKDLLDMLIDEGAQLVGTLDAKLVQKLYNRGLAYLEVPV… |
| A0A480IVM1 | 153-247 | ARDLLPVKPVEIAIEAWWVVQAGYITEDDIKICTLPEKCAIDKIIDAGPQLSGSLDYNVVHSLYNKGFIYLDVPISDDSCIAVPPLE… |
| A0A287FTV5 | 83-179 | None |
| D8QZ25 | 154-262 | None |
| M8AJB1 | 45-135 | None |
| A0A4V3WQC9 | 233-326 | None |
| A0A453EUT2 | 1-111 | None |
| A8I0M6 | 147-235 | None |
| A0A7R9C2C1 | 2-95 | None |
| A0A7R8ZJN4 | 267-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.