DPCstruct | MC612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 5.86 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4VCH9 | 3-72 | KKFYIYGVRPIFEEVEENYSTFYAFQFDTGEFKEDMTYASKIWSDFSGDAKEFTEEEFNAYVRELKTERG |
| A0A536PI32 | 29-101 | TYAIVGLRPVKAERTADGGMQVLAYDWKTGEFVPDGSYLAHLFMPSMLEDAGGDIDYVSKGEFERRVNELRSK |
| A0A1Q9TEJ6 | 258-332 | None |
| A0A7I8ER89 | 3-70 | None |
| A0A7K0DQW1 | 242-317 | None |
| A0A7T5R1R5 | 1-78 | None |
| A0A4R1PUU3 | 85-160 | None |
| A0A2A4Z6F8 | 2-73 | None |
| A0A1I2GV83 | 2-75 | None |
| A0A511N4D3 | 2-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.