DPCstruct | MC61196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 98 ± 20 aa |
| Standard deviation of domain lengths | 19.91 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12225 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5PYF6 | 28-129 | YFFEELLKRAIFDCRSCGQCILSTTGFVCPMRCPKTLRNGQCGGSYDGYCEVDKSKRCVWVEIFESAADLDRIEMLKKFQPPIDHRL… |
| A0A543D1D6 | 42-150 | PRALRLFTGLERRGKEALYGCRMCGQCALPATAYACPMTCPKQLRNGPCGGVAANGDCEVHPGQRCVWLIAWERAAATGHDADLALL… |
| A0A2N2PQX8 | 131-219 | None |
| A0A6L8W9X5 | 42-166 | None |
| A0A1E4IB57 | 41-155 | None |
| A0A381I5Z9 | 19-108 | None |
| A0A2G6EG55 | 28-146 | None |
| A0A7C7W8R3 | 14-89 | None |
| A0A7C5ESG4 | 17-147 | None |
| A0A5C7NU00 | 39-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.