DPCstruct | MC61195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 575 |
|---|---|
| Mean domain length (aa) | 199 ± 30 aa |
| Standard deviation of domain lengths | 30.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.01 |
| Pfam Score | 44.99 |
| Assigned Pfam label(s) | CL0023- PF11987- CL0063- CL0012- CL0740 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842SUB7 | 14-223 | LDTFELPPKPTDKPLRIPIQEVYTIRGVGTTPVGKVETGELNPGDDVIFMPSGEQGKVNSIETHYTKIDKAGPGDNIGFNIKGVARD… |
| A0A1V5PXN4 | 14-217 | PLSALIFDSYFDKYVGTVAKIRVYNGTMKKDDVIRMVSTGRDYNVGDVGVFRLSFEKRPQLGPGEVGYVIANIKSVTDTKIGDTITH… |
| A0A401FI79 | 140-325 | None |
| A0A5N3W478 | 161-353 | None |
| R4VQ58 | 289-449 | None |
| L5JNJ0 | 82-220 | None |
| A0A378B6Z4 | 2-217 | None |
| A0A2D0Q7Y8 | 282-467 | None |
| A0A7X5NKJ1 | 8-205 | None |
| A0A1Q9CA85 | 777-1011 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.