DPCstruct | MC61193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 189 ± 29 aa |
| Standard deviation of domain lengths | 28.85 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8R3I6 | 1-171 | MSKLLPFSSGISTTETPSLVRNRQRIESEYGMPLELQKELQALTLKSMLNENLVGADSELLQCLRKGPAGLWGECEDYALFVKRLAE… |
| A0A395HTT0 | 2-201 | AQMLPKGVLNHWNKLIAFTVTKAAPAFVASAGLLSNMSSSLPRIGKSLDPEGSERCLATYGMSVEAVETLDKLTMEYLFSENSTGIN… |
| F0XBL9 | 158-362 | None |
| A0A0G2GHI8 | 78-254 | None |
| A0A6S6VRK5 | 149-378 | None |
| A0A4Q4VFY7 | 232-403 | None |
| A0A4Q4XG76 | 1-135 | None |
| A0A3A2ZHQ7 | 8-139 | None |
| A0A0A2VTX0 | 6-220 | None |
| A0A3F3PQM2 | 706-907 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.