DPCstruct | MC61192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 3.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 95.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V8DJE5 | 1-62 | MPRQIRLPYVGIDKNGQTLSIKLGGGREKSGNGGATVVVLDNVAPNAKINYADGTAVNTVSP |
| G5K4K1 | 135-201 | TPIYKDRELIPRQIELQYVGIDNDGKLLAITIGGKSIQDSNGISKVTLDNSSPNASIDYATGRAQNT |
| J7TR50 | 2-62 | None |
| A0A224A7C0 | 68-133 | None |
| A0A496JMC8 | 72-146 | None |
| A0A1F0C8S3 | 2-69 | None |
| A0A659S9I7 | 179-244 | None |
| A0A5B8TDE9 | 74-139 | None |
| A0A0F2D3G3 | 25-90 | None |
| A0A496LZQ4 | 7-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.