DPCstruct | MC61164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 165 |
|---|---|
| Mean domain length (aa) | 320 ± 66 aa |
| Standard deviation of domain lengths | 66.09 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.68 |
| Pfam Score | 86.30 |
| Assigned Pfam label(s) | CL0135- CL0328- PF00199- PF06628 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S4AKH3 | 274-620 | TTLKVKTRYFHRIGVSGKGVLKMYDNIKGFPEHKIFRSGKHFPVIVRHSNSLSADDDARLDARGAALRILSDTTSDDGKAILDLTLK… |
| J0FGU2 | 43-321 | AAFDRERIPERVVHAKGSGAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTEEGNWDLVGN… |
| A0A1H5P336 | 11-262 | None |
| A0A7R9PZZ2 | 330-724 | None |
| A0A366RSH4 | 24-298 | None |
| A0A2P9I6C3 | 57-408 | None |
| A0A194UQ36 | 74-333 | None |
| A0A377ZG30 | 2-225 | None |
| A0A146HEU3 | 11-450 | None |
| A0A2T7A215 | 281-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.