DPCstruct | MC61163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Standard deviation of domain lengths | 9.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.03 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | CL0613- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D9VBI3 | 83-168 | SLSRCRIELTKIVSFVYIVDDIFDIVGTHDELSCFTQAIKMWDLVAADSLPRYMRSCYSAMYTVTNSIAHIVTREHGVNPINHLKK |
| A0A1S4A4K3 | 9-77 | ATIIDDIYDAYGSYDEHMCFTEALERWDVSAIDELPPYMKSCYLAILGVYAEMEEELAKRGESYRVDYA |
| A0A438DPH1 | 21-101 | None |
| A0A2G2X347 | 117-195 | None |
| A0A6A6LBC3 | 197-261 | None |
| A0A4S4F2L2 | 21-96 | None |
| A0A4S4CZA9 | 178-264 | None |
| A0A6P6G337 | 143-224 | None |
| A0A2H5PC36 | 111-175 | None |
| A0A4D8ZQ81 | 241-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.