DPCstruct | MC6116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 153 ± 20 aa |
| Standard deviation of domain lengths | 19.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1H0K6 | 10-163 | LFNVLLLTICSFLVFATAGLGSYFTSVGIDSGWYDSLNLPLWTPAGSVIGMVWTILYILLVISVFILLRQVDKRSFFLIGGVFLLNL… |
| A0A7C4EH07 | 6-155 | RLIVAIVACQSAGLLGALTTQTGSSSWYQQLHKPPFNPPGWVFGPVWTALYLMMAVAAWLVWRQGLSIRPVRVALVLFAVQLALNAA… |
| A0A7T9H6M6 | 3-132 | None |
| F9Y7U2 | 6-149 | None |
| A0A6A4KHK4 | 37-212 | None |
| A0A7S2V1B5 | 2-108 | None |
| M1V785 | 37-209 | None |
| A0A6N4MWK4 | 7-162 | None |
| G1SMF7 | 226-386 | None |
| Q8RKB5 | 14-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.