DPCstruct | MC61159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 4.03 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 32.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P7ZT07 | 802-871 | PDDQDTYRICAQAQPNQNASVLPQNLELRLLDKQQQVLAIVAAGQDDSFIQLPYFRGAATEPFAIEIVLG |
| A0A6M0CAA0 | 75-143 | PEGKEETNVLLQLYPRGQNCLPSNLKMEVLDENGNVFLEAESRKADNLIQLELNGDRGDSFSLQLTLRE |
| A0A6M0G7H7 | 210-286 | None |
| K9RIX1 | 295-363 | None |
| A0A354WD56 | 449-512 | None |
| A0A844M7I0 | 5-68 | None |
| A0A7X6CJ85 | 37-106 | None |
| A0A3C0NHW7 | 77-147 | None |
| A0A845ZWK5 | 219-280 | None |
| A0A6M0S569 | 234-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.