DPCstruct | MC61153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 202 ± 14 aa |
| Standard deviation of domain lengths | 13.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0VTC9 | 1-227 | MFGMPHHGSHSKRKRMLSLVYAKRTLQSSPSLLASTRILLEDRFIPYLQGLASAGEPVEMYDIFHAIAIDFISAYVFGLRHCSDYFR… |
| A0A0D9P870 | 106-311 | NYGVPHMFSTLGSREHSRRKRMISNVYSKSYIHASAPARAQSRAILLGRLVPLLRREAATPGANGTEVQSILMATTMDLISSYIFGL… |
| T0LE84 | 161-350 | None |
| A0A1V6PIK9 | 111-301 | None |
| A0A0G2EVS1 | 1-205 | None |
| A0A022VWW0 | 1-212 | None |
| A0A364MY20 | 719-902 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.