DPCstruct | MC61148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 180 ± 24 aa |
| Standard deviation of domain lengths | 23.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16496 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151P4S9 | 1-169 | MPVIKCFLDFKAGGALCHILAAAYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIYLQPDLEPKLLGKLKDIVK… |
| H2N0J1 | 82-279 | LPMKCFLDFKSGGALCHILAAAYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKSLVQNHCLSRPVIYLSSDIDPKLLGKLKDIIKR… |
| Q550R6 | 100-295 | None |
| A0A830HP99 | 66-259 | None |
| A0A183K8Q2 | 75-312 | None |
| A0A1I8I236 | 79-268 | None |
| A0A0D2NUX5 | 75-270 | None |
| A0A7S1PGU9 | 79-246 | None |
| A0A818DEV7 | 81-272 | None |
| A0A2K5PJA6 | 100-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.