DPCstruct | MC61147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 130 ± 11 aa |
| Standard deviation of domain lengths | 11.46 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151P4T2 | 1-117 | MALNAAGKDEELGWEPPSEAELKVLQARRERQDRISKLMGEYLLQGYRMLGDCCQDCGTILLQDQQKRLYCVACQELDSDVDKDNPG… |
| A0A397U0D4 | 50-161 | IEPTILNSQDSTSTHSAVNMSIEERREQSRRASQSIGQYLLQGWALIDEICPNDTCVGVPLLRSRDKKRYCVICQQYYINESDVDHS… |
| A0A4V1IUT5 | 42-181 | None |
| A0A0N4V9Q4 | 3-138 | None |
| A0A0N5A5N0 | 17-139 | None |
| A0A673I7L6 | 1-139 | None |
| A0A1S3KFF6 | 1-134 | None |
| A0A210QA50 | 1-146 | None |
| A0A4P9YT49 | 70-181 | None |
| A0A183HZU0 | 72-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.