DPCstruct | MC61146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 129 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 65.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02008 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151P024 | 12-139 | KKEELGKRRTSQGKKKSSQVRKKATSTRKTSTKAGSSEKCKKVPENDVKKKQQENKPTLNSSEKKKRRRCGVCEPCLRKTNCEECSC… |
| A0A484DAN6 | 1-116 | MPGPTAGPGPPSEDIYEFSMDEEEAQSLHLHRKSLEKTSPLSKYIETEHQQAGLFSLSPFYASVDPTVDLQKKKRKKCGDCTPCLRK… |
| A0A7J7VW52 | 2-140 | None |
| A0A3Q1BP76 | 62-197 | None |
| A0A671MUI9 | 13-165 | None |
| H3A1G6 | 146-269 | None |
| A0A287AHW9 | 129-286 | None |
| V4BZP6 | 3-128 | None |
| A0A401RZP9 | 258-405 | None |
| G3HVI2 | 53-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.