DPCstruct | MC61141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 98 ± 6 aa |
| Standard deviation of domain lengths | 6.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 47.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151NRD7 | 1-111 | MPDMEMPGAVGRTDLVFEEEDLQYEEEILRNPFSVKCWMRYIEFKQSAPRHALNLLYERALKELPGSYKLWYNYLKQRRKQVKNRCV… |
| A0A314UAF3 | 10-101 | SQDDLLYEEELLRNPFSLKLWWPYLIARSESPFKKRFIIYERALKALPGSYKLWSAYLHERLELVRNLPITHFQYETLNKTFERALV… |
| A0A6V7PA74 | 6-97 | None |
| A0A816IV61 | 1-99 | None |
| A0A482S8X3 | 1-93 | None |
| A0A7R9CJS2 | 39-147 | None |
| A0A7J8IEA4 | 1-107 | None |
| A0A6V7TJN2 | 6-99 | None |
| A0A183GYV3 | 50-143 | None |
| A0A0C2CBH2 | 28-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.