DPCstruct | MC61136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 123 ± 22 aa |
| Standard deviation of domain lengths | 22.36 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.93 |
| Pfam Score | 65.00 |
| Assigned Pfam label(s) | CL0369- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7W913 | 9-130 | DIYVFAELFTGSEESDNMFVNRLGISSLIREAQAAYDSHEQGRLVYKYGGDVVGAMIQKPVRPAPQSVAHAIFLDQSHDNPCPIESR… |
| A0A0S7FMN2 | 3-139 | DVARSQCPSLYVVAELFTGSEELDNIFVTRLGITSLIREAMSAGDSHEEGRLVYRYGGEPVGAFVQPSLRPLMPAIAHAMFLDVTHD… |
| T1GKN8 | 120-248 | None |
| A0A182T4T2 | 567-691 | None |
| A0A0R3S651 | 1-107 | None |
| A0A1C7MLY5 | 42-188 | None |
| A0A3P7E7H1 | 62-190 | None |
| A0A448WG43 | 8-106 | None |
| J9E4Y2 | 62-190 | None |
| A0A3P8J700 | 215-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.