DPCstruct | MC61135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 114 ± 10 aa |
| Standard deviation of domain lengths | 9.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F1L1Z5 | 9-129 | PRFHGSSSPVFHENDEDGCSTASAHSSRSSGQMEERQSERQDTRGPGRRSRDEELARQYALPASAAQISSMPLIELNRLMHTAQLSQ… |
| A0A2H1VRS4 | 1-95 | MSDGGSSATSSGQHLSRDEKRAKALGIPLEVQDIINLPMDEFNERLSKHDLSEAQLSLIRDIRRRGKNKVAAQNCRKRKLDQITSLA… |
| A0A3Q3VQG2 | 212-330 | None |
| A0A0B1T3K8 | 153-268 | None |
| A0A2G8KR30 | 155-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.