DPCstruct | MC61130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 168 |
|---|---|
| Mean domain length (aa) | 248 ± 50 aa |
| Standard deviation of domain lengths | 50.29 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0123- CL0392- CL0408 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A6B9V5 | 56-302 | PFHLLNHFYEVLLEPRYIDHSLRSSLLLFWVVDLAASILFVLLVAHSGRSSSIHRKFFHLTLSLVFLSGLLIDGPLLALSAALLLSI… |
| A0A0M0BG38 | 35-205 | VPAEYVGRKVVHVLNGGVTALVIPVCYEGYYWLVMVSAFLLAGYLYWRRKRRRMYWFQVPQNAYEVHFALSYGIVLMIGVLLGDVWI… |
| C3ZKS4 | 106-360 | None |
| A0A1E7FW97 | 17-200 | None |
| M1V6T3 | 189-446 | None |
| A0A812KKY3 | 354-577 | None |
| A0A0B5HZA6 | 6-197 | None |
| A0A077Y070 | 256-571 | None |
| A0A7J6KU59 | 142-460 | None |
| A0A0C3BTJ0 | 281-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.