DPCstruct | MC6113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 36.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7CC53 | 2-79 | KCPGQDMRFWKPGDIFDTQCTKCGRRVEFFKDEVRRKCRCGHEIVNPKLDFGCAQWCPYAEQCVGPLPEEVKERQKAG |
| D8K0K1 | 2-82 | KQQCPGQDTRRLKVELHRCPACRTEVEIFSDETRVVCHMCGEKVFREKTPSCIEWCVSARQCLGEDRWKELGQHFTEKGEH |
| A0A1G3QCJ4 | 2-83 | None |
| A0A7C3USV1 | 4-72 | None |
| A0A7C0YL21 | 3-65 | None |
| A0A2M8EJR4 | 2-90 | None |
| A0A7C0VDS8 | 15-87 | None |
| A0A7C7LCZ6 | 2-80 | None |
| A0A1F2PAE8 | 2-75 | None |
| A0A7C3YF64 | 6-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.