DPCstruct | MC61119
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 304 ± 35 aa |
| Standard deviation of domain lengths | 35.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.17 |
| Pfam Score | 93.83 |
| Assigned Pfam label(s) | PF12009- CL0027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1BJ48 | 33-310 | FDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQVFAFLKSQLKCLNLGDIFLNSLNTSIFFNYCKYLISMAYKAYLS… |
| A0A1Q2YJ99 | 13-325 | VNNNSDEKDNLSLSTEKSKVIEVIMTIIYKIIPVELFGTSKNRGLIMRSIPRLINTTVIAKISMEDVIRSVKLNQISWIKPRAQRTL… |
| B7XJU0 | 153-450 | None |
| A0A226EVD5 | 656-910 | None |
| A0A0G2FKF0 | 2-262 | None |
| A0A834QA19 | 403-714 | None |
| A0A0C2MRD9 | 237-522 | None |
| A0A445JF71 | 159-506 | None |
| A0A0N0RSV1 | 2-301 | None |
| H3ADV1 | 599-909 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.