DPCstruct | MC61115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 111 ± 23 aa |
| Standard deviation of domain lengths | 23.47 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0424 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1I197 | 9-80 | QPSSPERTSFAWQLAVGPALARVTSVQLEGTTLTVRSADPRWLKEIDRAKAVVLPKVQHLLGADAVTKIRTR |
| A0A4R2PH72 | 40-151 | ARRGGVVRAGALVPALTGRVMRARGFIKAEIVTRWDTVVGEDLASITRPVAVRFPRGKRAGATLVVRAAPATATVLQHRAPTVVERV… |
| A0A3N1KTM1 | 42-155 | None |
| A0A2M7V6B9 | 11-96 | None |
| A0A2E6ELJ0 | 5-98 | None |
| A0A1S6RY52 | 1-148 | None |
| A0A1E4HP80 | 1-147 | None |
| A0A192IQW2 | 1-123 | None |
| A0A644SVS9 | 5-109 | None |
| U2SZT0 | 6-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.