DPCstruct | MC6111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 8.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 50.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2FJC8 | 1-94 | MSEFDEYIVHGEPGQREKADAWQTAIGLQDVDGLKVSSYLLDTARQHIEGDISIEEAHDRIKVYYETKSGHDAVDEEGDKASVNIAK… |
| A0A1H8NUM4 | 12-83 | DYKYSEKYKRELWNTSFGLQKTDGLKPSEYLISLSEEEVKGNKTYEEIGEELDKYYSSSDVDKETEEADKVS |
| G5SLR1 | 1-99 | None |
| A0A1M6TEN2 | 7-105 | None |
| A0A4R3Y3C7 | 1-99 | None |
| D4IW01 | 3-94 | None |
| A0A7H8VMF8 | 4-84 | None |
| G1W8N2 | 1-97 | None |
| A0A134C3Z9 | 11-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.