DPCstruct | MC61103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 198 |
|---|---|
| Mean domain length (aa) | 134 ± 27 aa |
| Standard deviation of domain lengths | 26.68 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 69.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2TJV3 | 1-81 | MPLEREEHARSREERRRRRRATAKYRSAHACRERIRVVAFNVAFGELRRLLPTLPPDKRMSKIEILRLAVCYISYLNHVLD |
| A0A7M4EP17 | 2-134 | MPTALTMEKGPEGGYCCAAAAGSFPPSPASPGFPYECCGAGGAELLSPGARLKALGSARRRRRARSEAELQQLRQAANVRERRRMQS… |
| A0A3P9KGP2 | 1-83 | None |
| R7UB83 | 5-189 | None |
| A0A5B7EXA2 | 143-265 | None |
| A0A340XUZ4 | 95-266 | None |
| A0A2C9JKB4 | 56-223 | None |
| A0A2C9JQP1 | 111-233 | None |
| A0A3Q0ITT8 | 1-174 | None |
| A0A6J3CXW8 | 1-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.