DPCstruct | MC61101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 483 |
|---|---|
| Mean domain length (aa) | 169 ± 32 aa |
| Standard deviation of domain lengths | 31.74 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.03 |
| Pfam Score | 94.95 |
| Assigned Pfam label(s) | PF00631- PF09785- CL0272- PF16613- PF02194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3E8C1 | 5-124 | GAHTYPDTIDTIVADSTFVKVFFNHLVAELSPENLLFYLGGFDPRATYPVFIQLGAKHQINISSAQREPMDELAAAGDWDNVEWVRL… |
| A0A7M4DXH0 | 31-188 | VYSFFCHSGTPLASVPQAHAPVSYRWLCYCSPHLFLFISADGLAAFRAFLKSEFSEENIEFWLACEDFKKTKSSVKIASKAQKIYSE… |
| O45524 | 112-266 | None |
| A0A0M3IPP1 | 93-330 | None |
| A0A0M3IRP7 | 13-145 | None |
| A0A6V7WPT6 | 1-195 | None |
| A0A183MHP6 | 221-428 | None |
| A0A433DN14 | 31-202 | None |
| A0A6J3BV50 | 40-215 | None |
| A0A7N8XLB4 | 36-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.