DPCstruct | MC611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 84 ± 6 aa |
| Standard deviation of domain lengths | 6.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02700 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536PHB2 | 123-204 | MPRFVARVLIRPKAEIRDPQGEAISGALRSLGHEIADVRTGKEILVSFDAADERAARDEAARMGDELLANPVIESYAVEVEA |
| A0A3M1FVT1 | 2-80 | FKAKVVVKLREDVLDVQGKAIEEALQASYKEVKDVRVGKVITFNINTKSDLKALKISQQITEELLVNPLIEDYTLDVWD |
| A0A3A4U4M5 | 270-359 | None |
| A0A0P7YBU8 | 22-102 | None |
| A0A5Q4FTL1 | 797-884 | None |
| A0A6J4QZR4 | 95-177 | None |
| A0A523S5W4 | 1-69 | None |
| A0A1F9V1J2 | 10-92 | None |
| A0A535VP93 | 2-82 | None |
| A0A838UWJ9 | 21-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.