DPCstruct | MC61097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 163 ± 21 aa |
| Standard deviation of domain lengths | 21.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A0DA13 | 1-144 | MGPIFSERVIHAPTEPEIHGAHDALAVSLHETGRVDLPLIAELLGRSEADTLAELGESVYLDPERSAQGRDVWVTSDEMLSGAVRTK… |
| A0A1S7PEQ5 | 121-267 | TGEKARAATAEKAAIFTRRTQQPYRRPTSASSAKDALATVLNDYGRINLEAMSQLYGKPVDAIVDELGPLVFKTPTGAYETADQYLS… |
| A0A0K2RV37 | 387-515 | None |
| A0A380K0E4 | 80-248 | None |
| A0A4U8U4B9 | 1-195 | None |
| A0A6D2C1Q0 | 153-328 | None |
| A0A6F9ZEE0 | 261-412 | None |
| A0A1Q6V0T9 | 99-290 | None |
| A0A0X3XPP8 | 510-664 | None |
| R9H560 | 531-682 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.