DPCstruct | MC61095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 89 ± 18 aa |
| Standard deviation of domain lengths | 17.97 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0170 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2KZ06 | 1-78 | MGVGGLLANPGAAHAESRTLNIEFVHTGERASITFKRNGRYDPKGLKQLNYILRDWRRNEPTKMDPRLFDLVWEVYRQ |
| A0A7C2QQ88 | 30-99 | GARDRTISFHSVNTKETLTVQYMRNGKHVPEAMQQINWILRDWRRDEATEMDPALIDLVWEVHNELGSQE |
| A0A7W8HTX0 | 1-92 | None |
| A0A0Q7YJF7 | 1-136 | None |
| A0A1E3VT36 | 7-90 | None |
| A0A353XXX1 | 17-105 | None |
| A0A853HRL1 | 2-111 | None |
| A0A1H4LI39 | 1-79 | None |
| A0A351UHP9 | 7-89 | None |
| A0A1H1KE85 | 19-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.