DPCstruct | MC61094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 154 ± 22 aa |
| Standard deviation of domain lengths | 21.68 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8WJR8 | 1-172 | MLVKRIDGDGFTGIETVGGLNPQLMVGQRVIVHSRESVNGVIVPWKRGHPVPELHEILIDVGMPVDDVRSAVEIGDVVMFAQDLSLL… |
| A0A150JXP7 | 1-177 | MIAGHMDEVGFMVTQIDESGFLRFQTIGGWWSQVMLAQRVTVVTDKGDVTGVIGSKPPHILSPDARKKSYDIKDMFIDIGATSREEA… |
| A0A346E0T0 | 89-229 | None |
| A0A376TZR3 | 134-303 | None |
| A0A535KUC5 | 524-690 | None |
| D5WWI6 | 67-214 | None |
| A0A0L6JK02 | 2-123 | None |
| A0A420Z2K1 | 1-125 | None |
| A0A496KGK3 | 2-120 | None |
| A0A7G1IRC8 | 73-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.