DPCstruct | MC61093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 129 ± 19 aa |
| Standard deviation of domain lengths | 19.12 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 67.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B6XBS2 | 319-446 | HGGISRGCSKNAGAAGTLYDAVPRSLNVNNYNLSTDTETLLLEFPYQPLWTNVYIRNCARASVPLLWSRVQASELIVQGQISLLCGG… |
| A0A287F010 | 319-441 | HGGRSSGCPGNAGAAGTLYEEVPKSITVSNNNLSTQTDTVFLDPPYEPLWTNVFIKNHAKVSLPLRWSRLQAQGQISLLSRATLTFG… |
| A0A287GXU2 | 77-241 | None |
| A0A287KCP5 | 189-297 | None |
| A0A453A9X6 | 3-150 | None |
| A0A1D6LZX3 | 323-453 | None |
| A0A453E6Z4 | 246-354 | None |
| A0A446IQS4 | 45-153 | None |
| A0A397Z4N3 | 267-398 | None |
| F4JV81 | 301-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.