DPCstruct | MC61091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 139 |
|---|---|
| Mean domain length (aa) | 155 ± 24 aa |
| Standard deviation of domain lengths | 24.21 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03638 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453A2B7 | 24-185 | SQQTCSCADLNCFHGGCACFTNEGVCSKDCKCRAKCKNILDNEETVTEKFAEHTKNKAPAAQTLPSGSVVAVLVPDTRAKPFPARKP… |
| A0A7S3QA68 | 97-220 | QKEKQLFEKLNPDLVGVNCRCVKSQCLKLYCDCFQSGKICGEHCMCVDCLNTEKESGEDGKRTIARSLCLLRKPHAFKKKVKVVGSG… |
| A0A0V0QI98 | 256-441 | None |
| A0A0R3Q758 | 2-140 | None |
| A0A4S4F2F5 | 63-226 | None |
| A0A7S2XTQ2 | 2-202 | None |
| A0A0Q9XAJ9 | 735-897 | None |
| A0A6I8P384 | 279-439 | None |
| A0A1Y1NBE1 | 44-223 | None |
| A0A0V0QZG9 | 226-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.