DPCstruct | MC61089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 13.16 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452ZW25 | 26-120 | HVVQNAGSERCCEALQKLRKHYDIVVNIQGDEPLIEPEIIDGVVMALQRAPDAVFSTAATALKPDDAFDTNRVKCVVDNQGYAIYFS… |
| E8T6A2 | 50-163 | DSVEVARVAKEAGARAAMTPSELPSGTDRVYRAVKGIECRFVINLQGDEPLVTPEHLKAVLKGLEAGANFSTVATPFRSAEEVKDPS… |
| A0A4Y7JQ98 | 195-296 | None |
| A0A6C2TWT5 | 149-266 | None |
| A0A2X5SFJ6 | 3-120 | None |
| A0A2D6U1G6 | 376-489 | None |
| A0A2P5A6Q0 | 19-118 | None |
| X1ATK4 | 1-104 | None |
| D4TMK8 | 52-167 | None |
| A0A7R9R5P0 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.