DPCstruct | MC61086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 137 ± 22 aa |
| Standard deviation of domain lengths | 21.77 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 66.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M0ZUX3 | 59-136 | SLRSFPMKKKPKKRERSCSKILTAQGPRDRRIRLSIAMARKFFDLQELLGFDKPSKTIDWLFTHSQVALEELTNWSTH |
| A0A452ZJE9 | 23-160 | DRRKFEPAAASRHWSASTESRIVRVSRVFGGKDRHSKVRTVKGLRDRRVRLSVPTAIQLYDLQDRLGLSQPSKVVDWLLNAAQHEID… |
| A0A5N6PUT0 | 50-187 | None |
| A0A1Q3DD74 | 70-194 | None |
| A0A166B186 | 1-107 | None |
| A0A7I8KNG2 | 7-166 | None |
| A0A7N0T824 | 2-130 | None |
| A0A4S4EN48 | 48-172 | None |
| K9MKL9 | 48-177 | None |
| A0A0E0BMU6 | 3-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.