DPCstruct | MC61085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 8.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452ZJ28 | 2-71 | GPLLYHFADAYGPDDDMSIELSLEDVKRVAYHYGFVMEMEKMIDTTYTANMVSMMQNRYRAAFWTMRKDV |
| A0A2R2MKC3 | 207-283 | KPGGYWINMGPLLYHFADMPNELSIELSYEDVKKVILQLGFLILEEKTNIKSGYTENPKSMLKYVYDCVYFVAQKPL |
| T1H7V4 | 12-79 | None |
| A0A3P7LGB5 | 9-77 | None |
| A0A4Y9YLX4 | 781-856 | None |
| I3S7R3 | 1-62 | None |
| A0A061QY85 | 121-202 | None |
| A0A835GVA2 | 375-457 | None |
| A0A074S2T3 | 789-866 | None |
| A0A0L8GSJ4 | 2-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.