DPCstruct | MC61080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 169 |
|---|---|
| Mean domain length (aa) | 86 ± 16 aa |
| Standard deviation of domain lengths | 16.42 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5P8W5 | 1-72 | MSYAELLPQLFQRSLLAPISSKRVDPPYPQGFNPNASCEYHTGAIGHFTEDCDQLKSKVQYLINSRLIHFQG |
| A0A2N9HSB5 | 53-135 | PRKAPKLKRKFDPLGAPIFKIFDHLCKRGHLKPVDPTPYPNPLPKNWDTSLYCHFHQKTGHSTNECTRLKHEIQDLIEHNVII |
| A0A2G3CXX9 | 1-82 | None |
| A0A438DFH7 | 289-350 | None |
| A0A803PSB2 | 1-81 | None |
| A0A1U8PMH9 | 232-312 | None |
| A0A1U8PQT0 | 151-228 | None |
| A0A5B6WNU0 | 4-106 | None |
| A0A438DBV8 | 143-217 | None |
| A0A438DMF3 | 199-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.