DPCstruct | MC61074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 154 |
|---|---|
| Mean domain length (aa) | 171 ± 33 aa |
| Standard deviation of domain lengths | 32.79 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9H5V4 | 536-694 | LDESVDVNNPRDELLRMVKSLSPKVVTLVEQESNTNTTPFYHRFVETLDYYLAMFESIDVTLPRNSKDRINVEQHCLARDIVNIIAC… |
| A0A4U5QC03 | 27-176 | GNLLAMIRDQAPNIVTVIEQEASHNGPYFLGRFLEALHYYSAIFDSLDATFPPDSSQRAKVEQYIFAPEIRNIVACEGAERFERHER… |
| A0A834SLP9 | 712-900 | None |
| A0A446Q748 | 8-109 | None |
| A0A4S9M1B3 | 1-197 | None |
| A0A6D2I7T6 | 406-592 | None |
| A0A6A6KTB4 | 172-338 | None |
| A0A444WSB6 | 97-276 | None |
| A0A3N7G332 | 171-351 | None |
| A0A2G3B5G3 | 679-870 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.